DISPLAY QMGR

Use the MQSC command DISPLAY QMGR to display the queue manager parameters for this queue manager.


Use MQSC commands

For information on how we use MQSC commands, see Performing local administration tasks using MQSC commands.

We can issue this command from sources 2CR. For an explanation of the source symbols, see Sources from which we can issue MQSC commands on z/OS .

Synonym: DIS QMGR


DISPLAY QMGR

DISPLAY QMGR ALL CMDSCOPE(' ')CMDSCOPE(qmgr-name)1CMDSCOPE(*)12,SYSTEMEVENTCHINITCLUSTERPUBSUBqueue manager system attributesevent control attributesdistributed queuing attributescluster attributesqueue manager publish/subscribe attributesQueue manager system attributes,ACCTCONO3ACCTINT3ACCTMQI3ACCTQACTIVRECACTVCONO3ACTVTRC3ADVCAPALTDATEAMQPCAP3ALTTIMECCSIDCFCONLOS2CMDLEVELCOMMANDQCONNAUTHCPILEVEL2CRDATE3CRTIME3CUSTOMDEADQDESCRDISTL3EXPRYINT2GROUPUR2IMGINTVL3IMGLOGLN3IMGRCOVO3IMGRCOVQ3IMGSCHED3MARKINTMAXHANDSMAXMSGLMAXPROPLMAXPRTYMAXUMSGSMONQPLATFORMQMNAMEQSGNAME2ROUTERECSCMDSERV3SCYCASE2SPLCAPSQQMNAME2STATINT3STATMQI3STATQ3SYNCPTTRIGINTVERSIONXRCAPEvent control attributes,AUTHOREVBRIDGEEV2CHLEVCMDEVCONFIGEVINHIBTEVLOCALEVLOGGEREV3PERFMEVREMOTEEVSSLEVSTRSTPEVDistributed queuing attributes for z/OS ,ACTCHLADOPTCHKADOPTMCACERTLABLCERTQSGLCHADEXITCHIADAPSCHIDISPSCHISERVPCHLAUTHCHLEVDEADQDEFXMITQDNSGROUPDNSWLMIGQIGQAUTIGQUSERIPADDRVLSTRTMRLUGROUPLUNAMELU62ARMLU62CHLMAXCHLMONACLSMONCHLOPORTMAXOPORTMINQMIDRCVTIMERCVTMINRCVTTYPEREVDNSSSLCRLNLSSLEVSSLFIPSSSLKEYRSSLRKEYCSSLTASKSSTATACLSSTATCHLTCPCHLTCPKEEPTCPNAMETCPSTACKTRAXSTRTRAXTBLDistributed queuing attributes for other platforms ,CERTVPOL4CHAD3CHADEV3CHADEXITCERTLABLCHLEVCHLAUTHDEADQDEFXMITQIPADDRVMONCHLQMIDREVDNSSCHINIT3SSLCRLNLSSLCRYP5SSLEVSSLFIPS4SSLKEYRSSLRKEYCSTATCHLSUITEB5Cluster attributes,CHADEXITCLWLDATACLWLEXITCLWLLENCLWLMRUCCLWLUSEQDEFCLXQMONACLSPSCLUSQMIDREPOSREPOSNLSTATACLSQueue manager publish/subscribe attributes,PARENTPSCLUSPSMODEPSNPMSGPSNPRESPSRTYCNTPSSYNCPTTREELIFENotes:

  • 1 Valid only on z/OS when the queue manager is a member of a queue sharing group.
  • 2 Valid only on z/OS.
  • 3 Not valid on z/OS.
  • 4 Not valid on IBM i.
  • 5 Valid only on UNIX, Linux, and Windows.


Parameter descriptions for DISPLAY QMGR

    ALL
    Specify this parameter to display all the parameters. If this parameter is specified, any parameters that are requested specifically are ineffective; all parameters are still displayed.

    On Multiplatforms, this parameter is the default if we do not request any specific parameters.

    CMDSCOPE
    This parameter applies to z/OS only and specifies how the command runs when the queue manager is a member of a queue sharing group.

      ' '
      The command runs on the queue manager on which it was entered. This command is the default value.

      qmgr-name
      The command runs on the queue manager you specify, providing the queue manager is active within the queue sharing group.

      We can specify a queue manager name, other than the queue manager on which the command was entered, only if we are using a queue sharing group environment and if the command server is enabled.

      *
      The command runs on the local queue manager and is also passed to every active queue manager in the queue sharing group. The effect of running this command is the same as entering the command on every queue manager in the queue sharing group.

    SYSTEM
    Specify this parameter to display the set of queue manager system attributes that are available in the Queue manager system attrs list. See Requested parameters for information about these parameters.

    If you specify this parameter, any request you make to display individual parameters within this set is ineffective.

    EVENT
    Specify this parameter to display the set of event control attributes that are available in the Event control attrs list. See Requested parameters for information about these parameters.

    If you specify this parameter, any request you make to display individual parameters within this set is ineffective.

    CHINIT
    Specify this parameter to display the set of attributes relating to distributed queuing that are available in the Distributed queuing attrs list. We can also specify DQM to display the same set of attributes. See Requested parameters for information about these parameters.

    If you specify this parameter, any request you make to display individual parameters within this set is ineffective.

    CLUSTER
    Specify this parameter to display the set of attributes relating to clustering that are available in the Cluster attrs list. See Requested parameters for information about these parameters.

    If you specify this parameter, any request you make to display individual parameters within this set is ineffective.

    PUBSUB
    Specify this parameter to display the set of attributes relating to publish/subscribe that are available in the Queue manager pub/sub attrs list. See Requested parameters for information about these parameters.

    If you specify this parameter, any request you make to display individual parameters within this set is ineffective.


Requested parameters

Note: If no parameters are specified (and the ALL parameter is not specified or defaulted), the queue manager name is returned. We can request the following information for the queue manager:

    ACCTCONO
    Whether the settings of the ACCTQMQI and ACCTQ queue manager parameters can be overridden. This parameter is valid only on Multiplatforms.

    ACCTINT
    The interval at which intermediate accounting records are written. This parameter is valid only on Multiplatforms.

    ACCTMQI
    Whether accounting information is to be collected for MQI data. This parameter is valid only on Multiplatforms.

    ACCTQ
    Whether accounting data collection is to be enabled for queues.

    ACTCHL
    The maximum number of channels that can be active at any time.

    This parameter is valid only on z/OS.

    ACTIVREC
    Whether activity reports are to be generated if requested in the message.

    ACTVCONO
    Whether the settings of the ACTVTRC queue manager parameter can be overridden. This parameter is valid only on Multiplatforms.

    ACTVTRC
    Whether IBM MQ MQI application activity tracing information is to be collected. See Set ACTVTRC to control collection of activity trace information. This parameter is valid only on Multiplatforms.

    ADOPTCHK
    Which elements are checked to determine whether an MCA is adopted when a new inbound channel is detected with the same name as an already active MCA.

    This parameter is valid only on z/OS.

    ADOPTMCA
    Whether an orphaned MCA instance is to be restarted when a new inbound channel request matching the ADOPTCHK parameters is detected.

    This parameter is valid only on z/OS.

    ADVCAP
    Whether IBM MQ Advanced extended capabilities are available for a queue manager.

    On z/OS, the queue manager sets the value to be ENABLED, only if the value of QMGRPROD is ADVANCEDVUE. For any other value of QMGRPROD, or if QMGRPROD is not set, the queue manager sets the value to DISABLED. If ADVCAP is ENABLED we must be entitled to IBM MQ Advanced for z/OS Value Unit Edition (VUE). See START QMGR on z/OS and Installing IBM MQ Advanced for z/OS Value Unit Edition for more information.

    On other platforms, the queue manager sets the value to be ENABLED, only if you have installed Managed File Transfer, XR, Advanced Message Security or RDQM. If we have not installed Managed File Transfer, XR, Advanced Message Security or RDQM, ADVCAP is set to DISABLED. If ADVCAP is ENABLED, we must be entitled to IBM MQ Advanced. The list of installable components that enable ADVCAP might change in future releases. for more information, see IBM MQ components and features and Installing IBM MQ Advanced for Multiplatforms.

    ALTDATE
    The date on which the definition was last altered, in the form yyyy-mm-dd.

    ALTTIME
    The time at which the definition was last altered, in the form hh.mm.ss.

    AMQPCAP
    Whether AMQP capabilities are available for a queue manager.

    AUTHOREV
    Whether authorization events are generated.

    BRIDGEEV
    On z/OS only, whether IMS bridge events are generated.

    CCSID
    Coded character set identifier. This parameter applies to all character string fields defined by the application programming interface (API), including the names of objects, and the creation date and time of each queue. It does not apply to application data carried as the text of messages.

    CERTLABL
    Specifies the certificate label that this queue manager used.

    CERTQSGL
    Specifies the queue sharing group (QSG) certificate label.

    This parameter is valid only on z/OS.

    CERTVPOL
    Specifies which TLS certificate validation policy is used to validate digital certificates received from remote partner systems. This attribute can be used to control how strictly the certificate chain validation conforms to industry security standards. For more information about certificate validation policies, see Certificate validation policies in IBM MQ.

    This parameter is valid only on UNIX, Linux, and Windows.

    CFCONLOS
    Specifies the action to be taken when the queue manager loses connectivity to the administration structure, or any CF structure with CFCONLOS set to ASQMGR.

    This parameter is valid only on z/OS.

    CHAD
    Whether auto-definition of receiver and server-connection channels is enabled.
    This parameter is not valid on z/OS.

    CHADEV
    Whether auto-definition events are enabled.
    This parameter is not valid on z/OS.

    CHADEXIT
    The name of the channel auto-definition exit.

    CHIADAPS
    The number of adapter subtasks to use to process IBM MQ calls.

    This parameter is valid only on z/OS.

    CHIDISPS
    The number of dispatchers to use for the channel initiator.

    This parameter is valid only on z/OS.

    CHISERVP
    This field is reserved for IBM use only.

    CHLAUTH
    Whether channel authentication records are checked.

    CHLEV
    Whether channel events are generated.

    CLWLEXIT
    The name of the cluster workload exit.

    CLWLDATA
    The data passed to the cluster workload exit.

    CLWLLEN
    The maximum number of bytes of message data that is passed to the cluster workload exit.

    This parameter is not valid on Linux.

    CLWLMRUC
    The maximum number of outbound cluster channels.

    CLWLUSEQ
    The behavior of MQPUTs for queues where CLWLUSEQ has a value of QMGR.

    CMDEV
    Whether command events are generated.

    CMDLEVEL
    Command level. This indicates the level of system control commands supported by the queue manager.

    COMMANDQ
    The name of the system-command input queue. Suitably authorized applications can put commands on this queue.

    CONFIGEV
    Whether configuration events are generated.

    CONNAUTH
    The name of an authentication information object that is used to provide the location of user ID and password authentication.

    CPILEVEL
    Reserved, this value has no significance.

    CRDATE
    The date on which the queue manager was created (in the form yyyy-mm-dd).

    CRTIME
    The time at which the queue manager was created (in the form hh.mm.ss).

    CUSTOM
    This attribute is reserved for the configuration of new features before separate attributes have been introduced. It can contain the values of zero or more attributes as pairs of attribute name and value in the form NAME(VALUE).

    DEADQ
    The name of the queue to which messages are sent if they cannot be routed to their correct destination (the dead-letter queue or undelivered-message queue). The default is blanks. For example, messages are put on this queue when:

    • A message arrives at a queue manager, destined for a queue that is not yet defined on that queue manager
    • A message arrives at a queue manager, but the queue for which it is destined cannot receive it because, possibly:

      • The queue is full
      • The queue is inhibited for puts
      • The sending node does not have authority to put the message on the queue

    • An exception message must be generated, but the queue named is not known to that queue manager

    Note: Messages that have passed their expiry time are not transferred to this queue when they are discarded.

    If the dead-letter queue is not defined, or full, or unusable for some other reason, a message that would have been transferred to it by a message channel agent is retained instead on the transmission queue.

    If a dead-letter queue or undelivered-message queue is not specified, all blanks are returned for this parameter.

    DEFCLXQ
    The DFTCLXQ attribute controls which transmission queue is selected by default by cluster-sender channels to get messages from, to send the messages to cluster-receiver channels.

      SCTQ

      All cluster-sender channels send messages from SYSTEM.CLUSTER.TRANSMIT.QUEUE. The correlID of messages placed on the transmission queue identifies which cluster-sender channel the message is destined for.

      SCTQ is set when a queue manager is defined. This behavior is implicit in versions of IBM WebSphere MQ, earlier than Version 7.5. In earlier versions, the queue manager attribute DEFCLXQ was not present.

      CHANNEL
      Each cluster-sender channel sends messages from a different transmission queue. Each transmission queue is created as a permanent dynamic queue from the model queue SYSTEM.CLUSTER.TRANSMIT.MODEL.QUEUE.

    If the queue manager attribute, DEFCLXQ, is set to CHANNEL,the default configuration is changed to cluster-sender channels being associated with individual cluster transmission queues. The transmission queues are permanent-dynamic queues created from the model queue SYSTEM.CLUSTER.TRANSMIT.MODEL.QUEUE. Each transmission queue is associated with one cluster-sender channel. As one cluster-sender channel services a cluster transmission queue, the transmission queue contains messages for only one queue manager in one cluster. We can configure clusters so that each queue manager in a cluster contains only one cluster queue. In this case, the message traffic from a queue manager to each cluster queue is transferred separately from messages to other queues.

    DEFXMITQ
    Default transmission queue name. This parameter is the transmission queue on which messages, destined for a remote queue manager, are put if there is no other suitable transmission queue defined.

    DESCR
    Description.

    DISTL
    Whether distribution lists are supported by the queue manager.
    This parameter is not valid on z/OS.

    DNSGROUP
    This parameter is no longer used. See z/OS: WLM/DNS no longer supported. This parameter is valid only on z/OS

    DNSWLM
    This parameter is no longer used. See z/OS: WLM/DNS no longer supported. This parameter is valid only on z/OS.

    EXPRYINT
    On z/OS only, the approximate interval between scans for expired messages.

    GROUPUR
    On z/OS only, whether XA client applications are allowed to connect to this queue manager with a GROUP unit of recovery disposition.

    IMGINTVL
    The target frequency with which the queue manager automatically writes media images.
    This parameter is not valid on z/OS.

    IMGLOGLN
    The target amount of recovery log written by which the queue manager automatically writes media images.
    This parameter is not valid on z/OS.

    IMGRCOVO
    Whether specified objects are recoverable from a media image, if linear logging is being used.
    This parameter is not valid on z/OS.

    IMGRCOVQ
    Whether a local or permanent dynamic queue object is recoverable from a media image, if linear logging is being used.
    This parameter is not valid on z/OS.

    IMGSCHED
    Whether the queue manager automatically writes media images.
    This parameter is not valid on z/OS.

    IGQ
    On z/OS only, whether intra-group queuing is to be used.

    IGQAUT
    On z/OS only, displays the type of authority checking used by the intra-group queuing agent.

    IGQUSER
    On z/OS only, displays the user ID used by the intra-group queuing agent.

    INHIBTEV
    Whether inhibit events are generated.

    IPADDRV
    Whether to use an IPv4 or IPv6 IP address for a channel connection in ambiguous cases.

    LOCALEV
    Whether local error events are generated.

    LOGGEREV
    Whether recovery log events are generated. This parameter is valid only on Multiplatforms.

    LSTRTMR
    The time interval, in seconds, between attempts by IBM MQ to restart the listener after an APPC or TCP/IP failure.

    This parameter is valid only on z/OS.

    LUGROUP
    The generic LU name to be used by the LU 6.2 listener that handles inbound transmissions for the queue sharing group.

    This parameter is valid only on z/OS.

    LUNAME
    The name of the LU to use for outbound LU 6.2 transmissions.

    This parameter is valid only on z/OS.

    LU62ARM
    The suffix of the APPCPM member of SYS1.PARMLIB. This suffix nominates the LUADD for this channel initiator. When automatic restart manager (ARM) restarts the channel initiator, the z/OS command SET APPC= xx is issued.

    This parameter is valid only on z/OS.

    LU62CHL
    The maximum number of channels that can be current, or clients that can be connected, that use the LU 6.2 transmission protocol. If the value of LU62CHL is zero, the LU 6.2 transmission protocol is not used.

    This parameter is valid only on z/OS.

    MARKINT
    The mark browse interval in milliseconds.Attention: This value should not be below the default of 5000.

    MAXCHL
    The maximum number of channels that can be current (including server-connection channels with connected clients).

    This parameter is valid only on z/OS.

    MAXHANDS
    The maximum number of open handles that any one connection can have at any one time.

    MAXMSGL
    The maximum message length that can be handled by the queue manager. Individual queues or channels might have a smaller maximum than the value of this parameter.

    MAXPROPL ( integer )
    The maximum length of property data in bytes that can be associated with a message.

    MAXPRTY
    The maximum priority. This value is 9.

    MAXUMSGS
    Maximum number of uncommitted messages within one sync point. The default value is 10000.

    MAXUMSGS has no effect on MQ Telemetry. MQ Telemetry tries to batch requests to subscribe, unsubscribe, send, and receive messages from multiple clients into batches of work within a transaction.

    MONACLS
    Whether online monitoring data is to be collected for auto-defined cluster-sender channels, and, if so, the rate of data collection.

    MONCHL
    Whether online monitoring data is to be collected for channels, and, if so, the rate of data collection.

    MONQ
    Whether online monitoring data is to be collected for queues, and, if so, the rate of data collection.

    OPORTMAX
    The maximum value in the range of port numbers to be used when binding outgoing channels.

    This parameter is valid only on z/OS.

    OPORTMIN
    The minimum value in the range of port numbers to be used when binding outgoing channels.

    This parameter is valid only on z/OS.

    PARENT
    The name of the queue manager to which this queue manager is connected hierarchically as its child.

    PERFMEV
    Whether performance-related events are generated.

    PLATFORM
    The architecture of the platform on which the queue manager is running. The value of this parameter is:

    • MVS (for z/OS platforms)
    • NSK
    • OS2
    • OS400
    • APPLIANCE
    • UNIX
    • WINDOWSNT

    PSCLUS
    Controls whether this queue manager participates in publish subscribe activity across any clusters in which it is a member. No clustered topic objects can exist in any cluster when modifying from ENABLED to DISABLED.

    PSMODE
    Controls whether the publish/subscribe engine and the queued publish/subscribe interface are running, and therefore controls whether applications can publish or subscribe by using the application programming interface and the queues that are monitored by the queued publish/subscribe interface.

    PSNPMSG
    If the queued publish/subscribe interface cannot process a non-persistent input message it might attempt to write the input message to the dead-letter queue (depending on the report options of the input message). If the attempt to write the input message to the dead-letter queue fails, and the MQRO_DISCARD_MSG report option was specified on the input message or PSNPMSG=DISCARD, the broker discards the input message. If PSNPMSG=KEEP is specified, the interface only discards the input message if the MQRO_DISCARD_MSG report option was set in the input message.

    PSNPRES
    If the queued publish/subscribe interface attempts to generate a response message in response to a non-persistent input message, and the response message cannot be delivered to the reply-to queue, this attribute indicates whether the interface tries to write the undeliverable message to the dead-letter queue or whether to discard the message.

    PSRTYCNT
    When the queued publish/subscribe interface fails to process a command message under sync point (for example a publish message that cannot be delivered to a subscriber because the subscriber queue is full and it is not possible to put the publication on the dead letter queue), the unit of work is backed out and the command tries this number of times again before the broker attempts to process the command message according to its report options instead.

    PSSYNCPT
    If this attribute is set to IFPER, when the queued publish/subscribe interface reads a publish or delete publication messages from a stream queue during normal operation then it specifies MQGMO_SYNCPOINT_IF_PERSISTENT. This value makes the queued pubsub daemon receive non-persistent messages outside sync point. If the daemon receives a publication outside sync point, the daemon forwards that publication to subscribers known to it outside sync point.

    QMID
    The internally generated unique name of the queue manager.

    QMNAME
    The name of the local queue manager. See Rules for naming IBM MQ objects.

    QSGNAME
    The name of the queue sharing group to which the queue manager belongs, or blank if the queue manager is not a member of a queue sharing group. We can use queue sharing groups only on z/OS.

    RCVTIME
    The approximate length of time that a TCP/IP channel waits to receive data, including heartbeats, from its partner before returning to an inactive state. The value of this parameter is the numeric value qualified by RCVTTYPE.

    This parameter is valid only on z/OS.

    RCVTMIN
    The minimum length of time that a TCP/IP channel waits to receive data, including heartbeats, from its partner before returning to an inactive state.

    This parameter is valid only on z/OS.

    RCVTTYPE
    The qualifier to apply to the value in RCVTIME.

    This parameter is valid only on z/OS.

    REMOTEEV
    Whether remote error events are generated.

    REPOS
    The name of a cluster for which this queue manager is to provide a repository manager service.

    REPOSNL
    The name of a list of clusters for which this queue manager is to provide a repository manager service.

    REVDNS
    Whether reverse lookup of the host name from a Domain Name Server (DNS) is done for the IP address from which a channel has connected.

    ROUTEREC
    Whether trace-route information is to be recorded if requested in the message.

    SCHINIT
    Whether the channel initiator is to be started automatically when the queue manager starts.

    This parameter is not valid on z/OS.

    SCMDSERV
    Whether the command server is to be started automatically when the queue manager starts.

    This parameter is not valid on z/OS.

    SCYCASE
    Whether the security profiles are uppercase or mixed case.

    This parameter is valid only on z/OS.

    If this parameter has been altered but the REFRESH SECURITY command has not yet been issued, the queue manager might not be using the case of profiles you expect. Use DISPLAY SECURITY to verify which case of profiles is actually in use.

    SPLCAP

    Indicates if Advanced Message Security (AMS) capabilities are available to the queue manager. If the AMS component is installed for the version of IBM MQ that the queue manager is running under, the attribute has a value ENABLED. If the AMS component is not installed, the value is DISABLED.

    SQQMNAME
    When a queue manager makes an MQOPEN call for a shared queue and the queue manager that is specified in the ObjectQmgrName parameter of the MQOPEN call is in the same queue sharing group as the processing queue manager, the SQQMNAME attribute specifies whether the ObjectQmgrName is used or whether the processing queue manager opens the shared queue directly.

    This parameter is valid only on z/OS.

    SSLCRLNL
    Indicates the namelist of AUTHINFO objects being used for the queue manager for certificate revocation checking.

    Only authentication information objects with types of LDAPCRL or OCSP are allowed in the namelist referred to by SSLCRLNL. Any other type results in an error message when the list is processed and is subsequently ignored.

    SSLCRYP
    Indicates the name of the parameter string being used to configure the cryptographic hardware present on the system. The PKCS #11 password appears as xxxxxx. This is valid only on UNIX, Linux, and Windows.

    SSLEV
    Whether TLS events are generated.

    SSLFIPS
    Whether only FIPS-certified algorithms are to be used if cryptography is processed in IBM MQ rather than in the cryptographic hardware itself.

    SSLKEYR
    Indicates the name of the Secure Sockets Layer key repository.

    SSLRKEYC
    Indicates the number of bytes to be sent and received within an TLS conversation before the secret key is renegotiated.

    SSLTASKS
    On z/OS only, indicates the number of server subtasks to use for processing TLS calls.

    STATACLS
    Whether statistics data is to be collected for auto-defined cluster-sender channels, and, if so, the rate of data collection.

    STATCHL
    It determines whether statistics data is to be collected for channels, and, if so, the rate of data collection.

    STATINT
    The interval at which statistics monitoring data is written to the monitoring queue. This parameter is valid only on Multiplatforms.

    STATMQI
    Whether statistics monitoring data is to be collected for the queue manager. This parameter is valid only on Multiplatforms.

    STATQ
    Whether statistics data is to be collected for queues. This parameter is valid only on Multiplatforms.

    STRSTPEV
    Whether start and stop events are generated.

    SUITEB
    Whether Suite B compliant cryptography is used. For more information about Suite B configuration and its effect on TLS channels, see NSA Suite B Cryptography in IBM MQ .

    SYNCPT
    Whether sync point support is available with the queue manager. This is a read only queue manager attribute.

    TCPCHL
    The maximum number of channels that can be current, or clients that can be connected, that use the TCP/IP transmission protocol. If zero, the TCP/IP transmission protocol is not used.

    This parameter is valid only on z/OS.

    TCPKEEP
    Whether the KEEPALIVE facility is to be used to check that the other end of the connection is still available. If it is unavailable, the channel is closed.

    This parameter is valid only on z/OS.

    TCPNAME
    The name of the preferred TCP/IP stack to be used in a CINET multiple stack environment. In INET single stack environments the channel initiator uses the only available TCP/IP stack.

    This parameter is valid only on z/OS.

    TCPSTACK
    Whether the channel initiator uses only the TCP/IP stack specified in TCPNAME, or can optionally bind to any of the TCP/IP stacks defined in a CINET multiple stack environment.

    This parameter is valid only on z/OS.

    TRAXSTR
    Whether channel initiator trace starts automatically.

    This parameter is valid only on z/OS.

    TRAXTBL
    The size, in megabytes, of the trace data space of the channel initiator.

    This parameter is valid only on z/OS.

    TREELIFE
    The lifetime of non-administrative topics.

    TRIGINT
    The trigger interval.

    VERSION
    The version of the IBM MQ installation that the queue manager is associated with. The version has the format VVRRMMFF:
    VV: Version
    RR: Release
    MM: Maintenance level
    FF: Fix level

    XRCAP
    Whether MQ Telemetry capability is supported by the queue manager.

For more information about these parameters, see ALTER QMGR. Parent topic: MQSC commands


Related information